C09p65950.1_BnaDARv10-PA (polypeptide) Brassica napus

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of C09p65950.1_BnaDARv10-RA vs. GenBank_protein
Analysis Date: 2021-04-17 (Diamond on Darmor-bzh OGS10 v10 vs NR)
Total hits: 20
ZOOM
x 1
POSITION
0
MNRRSVVLSLLLQKLEIPPSVFSTPGALIDSGTVVSRLPPKAYAALRSAFVAEMSQYPTAAGFLILDTCFDFTGFETVTLPRVSFTFSGGVVVDLEPTGILYSPTTSYYCLAFAGNDDDGKAAIFGSAQQQTLEVVYDGVGGRVGFAPNGCN.20406080100120140Expect = 4.18e-102 / Id = 99.34Expect = 2.70e-96 / Id = 100.00Expect = 2.78e-89 / Id = 97.86Expect = 1.07e-85 / Id = 90.65Expect = 2.54e-84 / Id = 91.37Expect = 3.74e-66 / Id = 72.14Expect = 1.19e-64 / Id = 71.43Expect = 2.46e-64 / Id = 72.86Expect = 3.99e-64 / Id = 71.43Expect = 1.06e-63 / Id = 72.86SequenceVDD34095.1XP_013608480.1XP_013710761.1VDD20136.1XP_033138824.1BAF01928.1XP_010424699.1RID73211.1AAM74221.1XP_006287637.1
Match NameE-valueIdentityDescription
VDD34095.14.180e-10299.34unnamed protein product [Brassica oleracea][more]
XP_013608480.12.700e-96100.00PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL... [more]
XP_013710761.12.780e-8997.86aspartyl protease family protein At5g10770-like [B... [more]
VDD20136.11.070e-8590.65unnamed protein product [Brassica rapa][more]
XP_033138824.12.540e-8491.37aspartyl protease family protein At5g10770-like, p... [more]
BAF01928.13.740e-6672.14nucleoid DNA-binding protein cnd41 - like protein,... [more]
XP_010424699.11.190e-6471.43PREDICTED: aspartyl protease family protein At5g10... [more]
RID73211.12.460e-6472.86hypothetical protein BRARA_B00375 [Brassica rapa][more]
AAM74221.13.990e-6471.43putative chloroplast nucleoid DNA-binding protein,... [more]
XP_006287637.11.060e-6372.86aspartyl protease family protein At5g10770 [Capsel... [more]

Pages

back to top