BolC1t00451H-R (mRNA) Brassica oleracea HDEM
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >BolC1t00451H-R ID=BolC1t00451H-R|Name=BolC1t00451H-R|organism=Brassica oleracea HDEM|type=mRNA|length=204bp|location=Sequence derived from alignment at C1:2445384..2446154- (Brassica oleracea HDEM)|Notes=Excludes all bases but those of type(s): exon. ATGGCTAAGAATCCAGCGAAATCACAACAAAATCTCCAACTGAATCGAGCback to top protein sequence of BolC1t00451H-R >BolC1t00451H-R-P ID=BolC1t00451H-R-P|Name=BolC1t00451H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=68bp MAKNPAKSQQNLQLNRAPRYKNPDLCSTSSRTAEFLCLGDVASIETTNGWback to top mRNA from alignment at C1:2445384..2446154- Legend: polypeptideCDSexon Hold the cursor over a type above to highlight its positions in the sequence below.>BolC1t00451H-R ID=BolC1t00451H-R|Name=BolC1t00451H-R|organism=Brassica oleracea HDEM|type=mRNA|length=771bp|location=Sequence derived from alignment at C1:2445384..2446154- (Brassica oleracea HDEM)back to top Coding sequence (CDS) from alignment at C1:2445384..2446154- >BolC1t00451H-R ID=BolC1t00451H-R|Name=BolC1t00451H-R|organism=Brassica oleracea HDEM|type=CDS|length=204bp|location=Sequence derived from alignment at C1:2445384..2446154- (Brassica oleracea HDEM)back to top Orthology
View orthology data for BolC1t00451H-R
|