BolC1t00045H-R (mRNA) Brassica oleracea HDEM
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >BolC1t00045H-R ID=BolC1t00045H-R|Name=BolC1t00045H-R|organism=Brassica oleracea HDEM|type=mRNA|length=435bp|location=Sequence derived from alignment at C1:197133..198038+ (Brassica oleracea HDEM)|Notes=Excludes all bases but those of type(s): exon. ATGGATAGCTTAACAAACTTGTATAGGCAGGCCTCAGTTAAACCAGAATAback to top protein sequence of BolC1t00045H-R >BolC1t00045H-R-P ID=BolC1t00045H-R-P|Name=BolC1t00045H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=145bp MDSLTNLYRQASVKPEYIIWAFYHNGSSIRSSVQVNMAPKKDKVPPPSSKback to top mRNA from alignment at C1:197133..198038+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>BolC1t00045H-R ID=BolC1t00045H-R|Name=BolC1t00045H-R|organism=Brassica oleracea HDEM|type=mRNA|length=906bp|location=Sequence derived from alignment at C1:197133..198038+ (Brassica oleracea HDEM)back to top Coding sequence (CDS) from alignment at C1:197133..198038+ >BolC1t00045H-R ID=BolC1t00045H-R|Name=BolC1t00045H-R|organism=Brassica oleracea HDEM|type=CDS|length=435bp|location=Sequence derived from alignment at C1:197133..198038+ (Brassica oleracea HDEM)back to top Orthology
View orthology data for BolC1t00045H-R
|