BolSC56t61237H-R-P (polypeptide) Brassica oleracea HDEM
Overview
Homology
BLAST of BolSC56t61237H-R vs. GenBank_protein
Match: VDD66009.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 67.8 bits (164), Expect = 4.750e-14 Identity = 34/34 (100.00%), Postives = 34/34 (100.00%), Query Frame = 0 Query: 1 MEFAPRNIATPTPHVNPTSLLSILIRSQRGSKSK 34 MEFAPRNIATPTPHVNPTSLLSILIRSQRGSKSK Sbjct: 1 MEFAPRNIATPTPHVNPTSLLSILIRSQRGSKSK 34
BLAST of BolSC56t61237H-R vs. GenBank_protein
Match: VDD65268.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 61.6 bits (148), Expect = 1.320e-11 Identity = 32/34 (94.12%), Postives = 32/34 (94.12%), Query Frame = 0 Query: 1 MEFAPRNIATPTPHVNPTSLLSILIRSQRGSKSK 34 MEFAPRNIAT PHVNPTSLLSILIRSQRGSKSK Sbjct: 1 MEFAPRNIATLPPHVNPTSLLSILIRSQRGSKSK 34 The following BLAST results are available for this feature:
BLAST of BolSC56t61237H-R vs. GenBank_protein
Analysis Date: 2022-03-19 (Diamond on OGS1.0 vs NR) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >BolSC56t61237H-R-P ID=BolSC56t61237H-R-P|Name=BolSC56t61237H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=35bpback to top |