BolC1t00325H-R (mRNA) Brassica oleracea HDEM
|  
         Overview 
             
 Alignments 
            The following features are aligned 
 Analyses 
            This mRNA is derived from or has results from the following analyses  
 Properties 
            
 Relationships 
             
      This mRNA is a part of the following gene feature(s): 
 The following CDS feature(s) are a part of this mRNA: 
 The following exon feature(s) are a part of this mRNA: 
 The following polypeptide feature(s) derives from this mRNA: 
 Sequences 
            The following sequences are available for this feature:  
  spliced messenger RNA >BolC1t00325H-R ID=BolC1t00325H-R|Name=BolC1t00325H-R|organism=Brassica oleracea HDEM|type=mRNA|length=186bp|location=Sequence derived from alignment at C1:1773401..1773586+ (Brassica oleracea HDEM)|Notes=Excludes all bases but those of type(s): exon. ATGTCTCTCTTAGCGTCCTTCTTTGGTTGCTTCGTTCCAAAATCTGGCTCback to top protein sequence of BolC1t00325H-R >BolC1t00325H-R-P ID=BolC1t00325H-R-P|Name=BolC1t00325H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=62bp MSLLASFFGCFVPKSGSKISSSDGSSNSKTLSLEKPKSKSKSPRAPMIVSback to top mRNA from alignment at C1:1773401..1773586+ Legend: CDSpolypeptideexon Hold the cursor over a type above to highlight its positions in the sequence below.>BolC1t00325H-R ID=BolC1t00325H-R|Name=BolC1t00325H-R|organism=Brassica oleracea HDEM|type=mRNA|length=186bp|location=Sequence derived from alignment at C1:1773401..1773586+ (Brassica oleracea HDEM)back to top Coding sequence (CDS) from alignment at C1:1773401..1773586+ >BolC1t00325H-R ID=BolC1t00325H-R|Name=BolC1t00325H-R|organism=Brassica oleracea HDEM|type=CDS|length=186bp|location=Sequence derived from alignment at C1:1773401..1773586+ (Brassica oleracea HDEM)back to top Orthology 
            View orthology data for BolC1t00325H-R
            
           |