BolSC49t61187H-R-P (polypeptide) Brassica oleracea HDEM
Overview
Homology
BLAST of BolSC49t61187H-R vs. GenBank_protein
Match: VDD65959.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 78.2 bits (191), Expect = 5.880e-18 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV 42 MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV Sbjct: 1 MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV 42 The following BLAST results are available for this feature:
BLAST of BolSC49t61187H-R vs. GenBank_protein
Analysis Date: 2022-03-19 (Diamond on OGS1.0 vs NR) Total hits: 1
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: Interproscan on OGS1.0
Date Performed: 2022-03-19
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >BolSC49t61187H-R-P ID=BolSC49t61187H-R-P|Name=BolSC49t61187H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=43bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|