C09p74090.1_BnaDARv10-PA (polypeptide) Brassica napus
Overview
Homology
BLAST of C09p74090.1_BnaDARv10-RA vs. GenBank_protein
Match: CDY10444.1 (BnaCnng03450D [Brassica napus] >VDD34817.1 unnamed protein product [Brassica oleracea]) HSP 1 Score: 123 bits (309), Expect = 8.260e-35 Identity = 60/60 (100.00%), Postives = 60/60 (100.00%), Query Frame = 0 Query: 1 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDASVQGNECVKYIAAITNLIQDNQDR 60 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDASVQGNECVKYIAAITNLIQDNQDR Sbjct: 1 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDASVQGNECVKYIAAITNLIQDNQDR 60
BLAST of C09p74090.1_BnaDARv10-RA vs. GenBank_protein
Match: KAF2537374.1 (hypothetical protein F2Q68_00023538 [Brassica cretica] >KAF2575100.1 hypothetical protein F2Q70_00006867 [Brassica cretica] >KAF3568192.1 hypothetical protein DY000_02019941 [Brassica cretica]) HSP 1 Score: 122 bits (306), Expect = 1.070e-33 Identity = 59/60 (98.33%), Postives = 60/60 (100.00%), Query Frame = 0 Query: 1 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDASVQGNECVKYIAAITNLIQDNQDR 60 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDAS+QGNECVKYIAAITNLIQDNQDR Sbjct: 1 MKKKKPAHQNHHCSYLKEEETQFPLRSRSKLLEKDASLQGNECVKYIAAITNLIQDNQDR 60 The following BLAST results are available for this feature:
BLAST of C09p74090.1_BnaDARv10-RA vs. GenBank_protein
Analysis Date: 2021-04-17 (Diamond on Darmor-bzh OGS10 v10 vs NR) Total hits: 2
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >C09p74090.1_BnaDARv10-PA ID=C09p74090.1_BnaDARv10-PA|Name=C09p74090.1_BnaDARv10-RA|organism=Brassica napus|type=polypeptide|length=61bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
Metabolic Model
View data from metabolic model for C09p74090.1_BnaDARv10-PA
|