Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS3.5
Date Performed: 2022-02-26
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | COILS | Coil | Coil | coord: 94..96 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 1..96 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 9..32 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 72..96 |
None | No IPR available | MOBIDB_LITE | mobidb-lite | disorder_prediction | coord: 34..59 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >BraAnng003930.3.5C.1-P1 ID=BraAnng003930.3.5C.1-P1|Name=BraAnng003930.3.5C.1|organism=Brassica rapa chifu|type=polypeptide|length=97bp MRVDANRSGNVNAAASSERGDQIRNGSLHQAKRRSSNGKREQDGSYDTSR KRRGTTSIHRECRIVSPAMMQRPPSAESTSSLSGSWSRHSHPLLSG. back to top
|