BolC9t59475H-R-P (polypeptide) Brassica oleracea HDEM

You are viewing a polypeptide, more information available on the corresponding mRNA page

Overview
NameBolC9t59475H-R
Unique NameBolC9t59475H-R-P
Typepolypeptide
OrganismBrassica oleracea HDEM (cv. HDEM, Wild cabbage)
Sequence length137
Homology
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: NP_001131276.1 (histone H3.2 [Zea mays] >NP_189372.1 Histone superfamily protein [Arabidopsis thaliana] >NP_201339.1 Histone superfamily protein [Arabidopsis thaliana] >NP_563838.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568227.1 Histone superfamily protein [Arabidopsis thaliana] >NP_568228.1 Histone superfamily protein [Arabidopsis thaliana] >XP_002264961.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002282606.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002285556.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002285562.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_002299242.1 histone H3.2 [Populus trichocarpa] >XP_002304754.1 histone H3.2 [Populus trichocarpa] >XP_002320408.2 histone H3.2 [Populus trichocarpa] >XP_002436522.1 histone H3.2 [Sorghum bicolor] >XP_002437869.1 histone H3.2 [Sorghum bicolor] >XP_002441172.1 histone H3.2 [Sorghum bicolor] >XP_002446458.1 histone H3.2 [Sorghum bicolor] >XP_002447846.1 histone H3.2 [Sorghum bicolor] >XP_002452234.1 histone H3.2 [Sorghum bicolor] >XP_002457320.1 histone H3.2 [Sorghum bicolor] >XP_002522502.1 histone H3.2 [Ricinus communis] >XP_002524630.1 histone H3.2 [Ricinus communis] >XP_002533558.1 histone H3.2 [Ricinus communis] >XP_002533561.1 histone H3.2 [Ricinus communis] >XP_002533563.1 histone H3.2 [Ricinus communis] >XP_002533564.1 histone H3.2 [Ricinus communis] >XP_002873454.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_002877046.2 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_002894648.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_004139024.2 histone H3.2 [Cucumis sativus] >XP_004142133.1 histone H3.2 [Cucumis sativus] >XP_004229355.1 histone H3.2 [Solanum lycopersicum] >XP_004229356.1 histone H3.2 [Solanum lycopersicum] >XP_004229488.1 histone H3.2 [Solanum lycopersicum] >XP_004248123.1 histone H3.2 [Solanum lycopersicum] >XP_004293906.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004294584.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004294793.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004295221.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004300433.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_004952690.1 histone H3.2 [Setaria italica] >XP_004970697.1 histone H3.2 [Setaria italica] >XP_004975679.1 histone H3.2 [Setaria italica] >XP_006292533.1 histone H3.2 [Capsella rubella] >XP_006301260.2 histone H3.2 [Capsella rubella] >XP_006304637.1 histone H3.2 [Capsella rubella] >XP_006359169.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006359170.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006361042.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006364319.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006365266.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006366504.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006366505.1 PREDICTED: histone H3.2 [Solanum tuberosum] >XP_006386111.1 histone H3.2 [Populus trichocarpa] >XP_006386195.1 histone H3.2 [Populus trichocarpa] >XP_006394044.1 histone H3.2 [Eutrema salsugineum] >XP_006394194.1 histone H3.2 [Eutrema salsugineum] >XP_006396911.1 histone H3.2 [Eutrema salsugineum] >XP_006426310.1 histone H3.2 [Citrus clementina] >XP_006446007.1 histone H3.2 [Citrus clementina] >XP_006446012.1 histone H3.2 [Citrus clementina] >XP_006446027.1 histone H3.2 [Citrus clementina] >XP_006466277.1 histone H3.2 [Citrus sinensis] >XP_006493650.1 histone H3.2 [Citrus sinensis] >XP_006493653.1 histone H3.2 isoform X1 [Citrus sinensis] >XP_006493654.1 histone H3.2 isoform X2 [Citrus sinensis] >XP_006493658.1 histone H3.2 isoform X1 [Citrus sinensis] >XP_006493659.1 histone H3.2 isoform X2 [Citrus sinensis] >XP_006656199.1 histone H3.2 [Oryza brachyantha] >XP_006662745.1 histone H3.2 [Oryza brachyantha] >XP_006827607.1 histone H3.2 [Amborella trichopoda] >XP_006854535.1 histone H3.2 [Amborella trichopoda] >XP_007014937.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007014942.2 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007047838.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_007206130.1 histone H3.2 [Prunus persica] >XP_007206131.1 histone H3.2 [Prunus persica] >XP_007213974.1 histone H3.2 [Prunus persica] >XP_008219239.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008219284.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008243610.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008245364.1 PREDICTED: histone H3.2 [Prunus mume] >XP_008349461.1 histone H3.2 [Malus domestica] >XP_008383674.1 histone H3.2 [Malus domestica] >XP_008384460.1 histone H3.2 [Malus domestica] >XP_008384469.1 histone H3.2 [Malus domestica] >XP_008449740.1 PREDICTED: histone H3.2 [Cucumis melo] >XP_008466947.1 PREDICTED: histone H3.2 [Cucumis melo] >XP_008659267.1 histone H3.2 [Zea mays] >XP_008663191.2 histone H3.2 [Zea mays] >XP_008669428.2 histone H3.2 [Zea mays] >XP_008678686.1 histone H3.2 [Zea mays] >XP_008777421.1 histone H3.2 [Phoenix dactylifera] >XP_008781402.1 histone H3.2 [Phoenix dactylifera] >XP_008793940.1 histone H3.2 [Phoenix dactylifera] >XP_009110843.1 histone H3.2 [Brassica rapa] >XP_009112178.1 histone H3.2 [Brassica rapa] >XP_009114048.1 histone H3.2 [Brassica rapa] >XP_009125303.1 histone H3.2 [Brassica rapa] >XP_009129719.2 histone H3.2 [Brassica rapa] >XP_009131154.1 histone H3.2 [Brassica rapa] >XP_009352838.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009364707.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009364738.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009374897.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009379413.1 PREDICTED: histone H3.2 [Pyrus x bretschneideri] >XP_009399186.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009404906.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009405329.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009411937.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009418349.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009420590.1 PREDICTED: histone H3.2 [Musa acuminata subsp. malaccensis] >XP_009588612.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009588620.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009589159.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009594168.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009597397.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009612389.1 histone H3.2 [Nicotiana tomentosiformis] >XP_009768852.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009776512.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009790377.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009792014.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009794411.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009794577.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009795193.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_009800087.1 PREDICTED: histone H3.2 [Nicotiana sylvestris] >XP_010031842.1 histone H3.2 [Eucalyptus grandis] >XP_010033130.1 histone H3.2 [Eucalyptus grandis] >XP_010044997.1 histone H3.2 [Eucalyptus grandis] >XP_010087371.1 histone H3.2 [Morus notabilis] >XP_010087372.1 histone H3.2 [Morus notabilis] >XP_010091983.1 histone H3.2 [Morus notabilis] >XP_010091985.1 histone H3.2 [Morus notabilis] >XP_010111157.1 histone H3.2 [Morus notabilis] >XP_010241721.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010257371.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010257381.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010258545.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010260368.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010260930.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010263130.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010265797.1 PREDICTED: histone H3.2 [Nelumbo nucifera] >XP_010316780.1 histone H3.2 [Solanum lycopersicum] >XP_010324306.1 histone H3.2 [Solanum lycopersicum] >XP_010425488.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010444536.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010458200.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010463183.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010475747.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010484375.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010489841.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010502711.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010514443.1 PREDICTED: histone H3.2 [Camelina sativa] >XP_010536065.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_010544196.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_010673587.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010673590.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675450.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675457.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010675458.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010679903.1 PREDICTED: histone H3.2 [Beta vulgaris subsp. vulgaris] >XP_010904890.1 histone H3.2 [Elaeis guineensis] >XP_010911970.1 histone H3.2 [Elaeis guineensis] >XP_010912408.1 histone H3.2 [Elaeis guineensis] >XP_010930992.1 histone H3.2 [Elaeis guineensis] >XP_011028938.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011037873.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011037877.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011037963.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011042066.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011042070.1 PREDICTED: histone H3.2 [Populus euphratica] >XP_011080254.1 histone H3.2 [Sesamum indicum] >XP_011087280.1 histone H3.2 [Sesamum indicum] >XP_011088023.2 histone H3.2 [Sesamum indicum] >XP_011090392.1 histone H3.2 [Sesamum indicum] >XP_011092467.1 histone H3.2 [Sesamum indicum] >XP_011093538.1 histone H3.2 [Sesamum indicum] >XP_011463287.1 PREDICTED: histone H3.2 [Fragaria vesca subsp. vesca] >XP_012071958.1 histone H3.2 [Jatropha curcas] >XP_012091683.1 histone H3.2 [Jatropha curcas] >XP_012092773.1 histone H3.2 [Jatropha curcas] >XP_012092775.1 histone H3.2 [Jatropha curcas] >XP_012447072.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012452274.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012455372.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012456013.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012464460.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012465103.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012473340.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012477143.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012477145.1 PREDICTED: histone H3.2 [Gossypium raimondii] >XP_012700296.1 histone H3.2 [Setaria italica] >XP_012700964.1 histone H3.2 [Setaria italica] >XP_012828407.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012829025.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012829914.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012830336.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012835372.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_012849881.1 PREDICTED: histone H3.2 [Erythranthe guttata] >XP_013599938.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013606481.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013609086.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013618388.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013621521.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013637372.1 PREDICTED: histone H3.2 [Brassica oleracea var. oleracea] >XP_013657686.1 histone H3.2 [Brassica napus] >XP_013678750.1 histone H3.2 [Brassica napus] >XP_013680280.1 histone H3.2 [Brassica napus] >XP_013686742.1 histone H3.2 [Brassica napus] >XP_013686753.1 histone H3.2 [Brassica napus] >XP_013698649.1 histone H3.2 [Brassica napus] >XP_013700674.1 histone H3.2 [Brassica napus] >XP_013700675.1 histone H3.2 [Brassica napus] >XP_013700676.1 histone H3.2 [Brassica napus] >XP_013712760.1 histone H3.2 [Brassica napus] >XP_013718218.1 histone H3.2 [Brassica napus] >XP_013718219.1 histone H3.2 [Brassica napus] >XP_013726586.1 histone H3.2 [Brassica napus] >XP_013731494.1 histone H3.2 [Brassica napus] >XP_013733475.1 histone H3.2 [Brassica napus] >XP_013738537.1 histone H3.2 [Brassica napus] >XP_013742827.1 histone H3.2 [Brassica napus] >XP_013742828.1 histone H3.2 [Brassica napus] >XP_013750874.1 histone H3.2 [Brassica napus] >XP_014660475.1 histone H3.2 [Setaria italica] >XP_015060267.1 histone H3.2 [Solanum pennellii] >XP_015060270.1 histone H3.2 [Solanum pennellii] >XP_015062471.1 histone H3.2 [Solanum pennellii] >XP_015062551.1 histone H3.2 [Solanum pennellii] >XP_015063022.1 histone H3.2 [Solanum pennellii] >XP_015063120.1 histone H3.2 [Solanum pennellii] >XP_015066930.1 histone H3.2 [Solanum pennellii] >XP_015088813.1 histone H3.2 [Solanum pennellii] >XP_015615109.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015639714.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015641515.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642925.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642926.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015642927.1 histone H3.2 [Oryza sativa Japonica Group] >XP_015693457.2 histone H3.2 [Oryza brachyantha] >XP_015867123.1 histone H3.2 [Ziziphus jujuba] >XP_015867128.1 histone H3.2 [Ziziphus jujuba] >XP_015875930.1 histone H3.2 [Ziziphus jujuba] >XP_015890987.1 histone H3.2 [Ziziphus jujuba] >XP_015945242.1 histone H3.2 [Arachis duranensis] >XP_015956408.1 histone H3.2 [Arachis duranensis] >XP_015962680.1 histone H3.2 [Arachis duranensis] >XP_016181780.1 histone H3.2 [Arachis ipaensis] >XP_016182163.1 histone H3.2 [Arachis ipaensis] >XP_016190032.1 histone H3.2 [Arachis ipaensis] >XP_016194363.1 histone H3.2 [Arachis ipaensis] >XP_016432553.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016432905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016437038.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016438522.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016444277.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016472604.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016476898.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016497344.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016497746.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016498067.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016498068.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016500339.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016502252.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016506905.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016514570.1 PREDICTED: histone H3.2 [Nicotiana tabacum] >XP_016541463.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016551871.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016554942.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016557393.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016557394.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016559802.1 PREDICTED: histone H3.2 [Capsicum annuum] >XP_016678479.1 histone H3.2 [Gossypium hirsutum] >XP_016679592.1 histone H3.2 [Gossypium hirsutum] >XP_016683567.1 histone H3.2 [Gossypium hirsutum] >XP_016690176.1 histone H3.2 [Gossypium hirsutum] >XP_016697979.1 histone H3.2 [Gossypium hirsutum] >XP_016698756.1 histone H3.2 [Gossypium hirsutum] >XP_016703464.1 histone H3.2 [Gossypium hirsutum] >XP_016717625.1 histone H3.2 [Gossypium hirsutum] >XP_016734760.1 histone H3.2 [Gossypium hirsutum] >XP_016753413.1 histone H3.2 [Gossypium hirsutum] >XP_017185745.1 histone H3.2 [Malus domestica] >XP_017226888.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017232071.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017234420.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017234599.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017234600.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017236362.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017258634.1 PREDICTED: histone H3.2 [Daucus carota subsp. sativus] >XP_017605698.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017621199.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017643103.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017646801.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017648889.1 PREDICTED: histone H3.2 [Gossypium arboreum] >XP_017980785.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_017981975.1 PREDICTED: histone H3.2 [Theobroma cacao] >XP_018433979.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018439713.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018445234.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018448989.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018448990.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018456938.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018456939.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018470661.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018470662.1 PREDICTED: histone H3.2 [Raphanus sativus] >XP_018727385.1 histone H3.2 [Eucalyptus grandis] >XP_018851506.1 histone H3.2 [Juglans regia] >XP_019059186.1 PREDICTED: histone H3.2 [Tarenaya hassleriana] >XP_019072373.1 PREDICTED: histone H3.2 [Vitis vinifera] >XP_019152654.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019152661.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019152669.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019168634.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019168898.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019186829.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019197722.1 PREDICTED: histone H3.2 [Ipomoea nil] >XP_019223782.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019223783.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019226053.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019230430.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019241236.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019246841.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019265433.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_019267355.1 PREDICTED: histone H3.2 [Nicotiana attenuata] >XP_020089911.1 histone H3.2 [Ananas comosus] >XP_020090239.1 histone H3.2 [Ananas comosus] >XP_020111776.1 histone H3.2 [Ananas comosus] >XP_020394886.1 histone H3.2 [Zea mays] >XP_020401458.1 histone H3.2 [Zea mays] >XP_020421876.1 histone H3.2 [Prunus persica] >XP_020867896.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_020876762.1 histone H3.2 [Arabidopsis lyrata subsp. lyrata] >XP_021275975.1 histone H3.2 [Herrania umbratica] >XP_021278674.1 histone H3.2 [Herrania umbratica] >XP_021300861.1 histone H3.2 [Herrania umbratica] >XP_021311652.1 histone H3.2 [Sorghum bicolor] >XP_021597539.1 histone H3.2 [Manihot esculenta] >XP_021597540.1 histone H3.2 [Manihot esculenta] >XP_021601079.1 histone H3.2 [Manihot esculenta] >XP_021601080.1 histone H3.2 [Manihot esculenta] >XP_021614994.1 histone H3.2 [Manihot esculenta] >XP_021629890.1 histone H3.2 [Manihot esculenta] >XP_021634528.1 histone H3.2 [Manihot esculenta] >XP_021636402.1 histone H3.2 [Hevea brasiliensis] >XP_021636735.1 histone H3.2 [Hevea brasiliensis] >XP_021639008.1 histone H3.2 [Hevea brasiliensis] >XP_021649553.1 histone H3.2 [Hevea brasiliensis] >XP_021649554.1 histone H3.2 [Hevea brasiliensis] >XP_021660493.1 histone H3.2 [Hevea brasiliensis] >XP_021666493.1 histone H3.2 [Hevea brasiliensis] >XP_021671981.1 histone H3.2 [Hevea brasiliensis] >XP_021719256.1 histone H3.2 [Chenopodium quinoa] >XP_021719258.1 histone H3.2 [Chenopodium quinoa] >XP_021719259.1 histone H3.2 [Chenopodium quinoa] >XP_021728938.1 histone H3.2 [Chenopodium quinoa] >XP_021761018.1 histone H3.2 [Chenopodium quinoa] >XP_021761196.1 histone H3.2 [Chenopodium quinoa] >XP_021771602.1 histone H3.2 [Chenopodium quinoa] >XP_021771603.1 histone H3.2 [Chenopodium quinoa] >XP_021772030.1 histone H3.2 [Chenopodium quinoa] >XP_021773746.1 histone H3.2 [Chenopodium quinoa] >XP_021773747.1 histone H3.2 [Chenopodium quinoa] >XP_021773748.1 histone H3.2 [Chenopodium quinoa] >XP_021813959.1 histone H3.2 [Prunus avium] >XP_021827292.1 histone H3.2 [Prunus avium] >XP_021830247.1 histone H3.2 [Prunus avium] >XP_021830879.1 histone H3.2 [Prunus avium] >XP_021843947.1 histone H3.2 [Spinacia oleracea] >XP_021843948.1 histone H3.2 [Spinacia oleracea] >XP_021853874.1 histone H3.2 [Spinacia oleracea] >XP_021857796.1 histone H3.2 [Spinacia oleracea] >XP_021860947.1 histone H3.2 [Spinacia oleracea] >XP_021863052.1 histone H3.2 [Spinacia oleracea] >XP_021894154.1 histone H3.2 [Carica papaya] >XP_021897494.1 histone H3.2 [Carica papaya] >XP_022148796.1 histone H3.2 [Momordica charantia] >XP_022150464.1 histone H3.2 [Momordica charantia] >XP_022552886.1 histone H3.2 [Brassica napus] >XP_022729530.1 histone H3.2 [Durio zibethinus] >XP_022730499.1 histone H3.2 [Durio zibethinus] >XP_022739834.1 histone H3.2 [Durio zibethinus] >XP_022749699.1 histone H3.2 [Durio zibethinus] >XP_022751113.1 histone H3.2 [Durio zibethinus] >XP_022753552.1 histone H3.2 [Durio zibethinus] >XP_022754286.1 histone H3.2 [Durio zibethinus] >XP_022775007.1 histone H3.2 [Durio zibethinus] >XP_022861044.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022865383.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022876676.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022879070.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022884247.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022896559.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022899180.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022899181.1 histone H3.2 [Olea europaea var. sylvestris] >XP_022929903.1 histone H3.2 [Cucurbita moschata] >XP_022944489.1 histone H3.2 [Cucurbita moschata] >XP_022958666.1 histone H3.2 [Cucurbita moschata] >XP_022959728.1 histone H3.2 [Cucurbita moschata] >XP_022959793.1 histone H3.2 [Cucurbita moschata] >XP_022961291.1 histone H3.2 [Cucurbita moschata] >XP_022988234.1 histone H3.2 [Cucurbita maxima] >XP_022992435.1 histone H3.2 [Cucurbita maxima] >XP_022995169.1 histone H3.2 [Cucurbita maxima] >XP_023004688.1 histone H3.2 [Cucurbita maxima] >XP_023005085.1 histone H3.2 [Cucurbita maxima] >XP_023511794.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023515063.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023515802.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023532072.1 histone H3.2 [Cucurbita pepo subsp. pepo] >XP_023908460.1 histone H3.2 [Quercus suber] >XP_023908461.1 histone H3.2 [Quercus suber] >XP_023908480.1 histone H3.2 [Quercus suber] >XP_024012002.1 histone H3.2 [Eutrema salsugineum] >XP_024157717.1 histone H3.2 [Rosa chinensis] >XP_024157718.1 histone H3.2 [Rosa chinensis] >XP_024157719.1 histone H3.2 [Rosa chinensis] >XP_024157720.1 histone H3.2 [Rosa chinensis] >XP_024158950.1 histone H3.2 [Rosa chinensis] >XP_024159430.1 histone H3.2 [Rosa chinensis] >XP_024159911.1 histone H3.2 [Rosa chinensis] >XP_024185577.1 histone H3.2 [Rosa chinensis] >XP_024452900.1 histone H3.2 [Populus trichocarpa] >XP_024454939.1 histone H3.2 [Populus trichocarpa] >XP_024922203.1 histone H3.2 [Ziziphus jujuba] >XP_024922204.1 histone H3.2 [Ziziphus jujuba] >XP_024976295.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_024983405.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_024996295.1 histone H3.2 [Cynara cardunculus var. scolymus] >XP_025623480.1 histone H3.2 [Arachis hypogaea] >XP_025638332.1 histone H3.2 [Arachis hypogaea] >XP_025682852.1 histone H3.2 [Arachis hypogaea] >XP_025683864.1 histone H3.2 [Arachis hypogaea] >XP_025696758.1 histone H3.2 [Arachis hypogaea] >XP_025806812.1 histone H3.2 [Panicum hallii] >XP_025808898.1 histone H3.2 [Panicum hallii] >XP_025810547.1 histone H3.2 [Panicum hallii] >XP_025811632.1 histone H3.2 [Panicum hallii] >XP_025817322.1 histone H3.2 [Panicum hallii] >XP_025817586.1 histone H3.2 [Panicum hallii] >XP_025823439.1 histone H3.2 [Panicum hallii] >XP_025823554.1 histone H3.2 [Panicum hallii] >XP_026377339.1 histone H3.2 [Papaver somniferum] >XP_026377346.1 histone H3.2 [Papaver somniferum] >XP_026377347.1 histone H3.2 [Papaver somniferum] >XP_026377365.1 histone H3.2 [Papaver somniferum] >XP_026380430.1 histone H3.2 [Papaver somniferum] >XP_026383068.1 histone H3.2 [Papaver somniferum] >XP_026384296.1 histone H3.2 [Papaver somniferum] >XP_026385459.1 histone H3.2 [Papaver somniferum] >XP_026385472.1 histone H3.2 [Papaver somniferum] >XP_026387005.1 histone H3.2 [Papaver somniferum] >XP_026389177.1 histone H3.2 [Papaver somniferum] >XP_026389449.1 histone H3.2 [Papaver somniferum] >XP_026389453.1 histone H3.2 [Papaver somniferum] >XP_026391977.1 histone H3.2 [Papaver somniferum] >XP_026392094.1 histone H3.2 [Papaver somniferum] >XP_026395342.1 histone H3.2 [Papaver somniferum] >XP_026399741.1 histone H3.2 [Papaver somniferum] >XP_026409804.1 histone H3.2 [Papaver somniferum] >XP_026411400.1 histone H3.2 [Papaver somniferum] >XP_026411980.1 histone H3.2 [Papaver somniferum] >XP_026413919.1 histone H3.2 [Papaver somniferum] >XP_026418304.1 histone H3.2 [Papaver somniferum] >XP_026436404.1 histone H3.2 [Papaver somniferum] >XP_026436793.1 histone H3.2 [Papaver somniferum] >XP_026436945.1 histone H3.2 [Papaver somniferum] >XP_026443329.1 histone H3.2 [Papaver somniferum] >XP_026443373.1 histone H3.2 [Papaver somniferum] >XP_026446052.1 histone H3.2 [Papaver somniferum] >XP_026452899.1 histone H3.2 [Papaver somniferum] >XP_026457231.1 histone H3.2 [Papaver somniferum] >XP_027090068.1 histone H3.2 [Coffea arabica] >XP_027094931.1 histone H3.2 [Coffea arabica] >XP_027107198.1 histone H3.2 [Coffea arabica] >XP_027113663.1 histone H3.2 [Coffea arabica] >XP_027113664.1 histone H3.2 [Coffea arabica] >XP_027149437.1 histone H3.2 [Coffea eugenioides] >XP_027155131.1 histone H3.2 [Coffea eugenioides] >XP_027158131.1 histone H3.2 [Coffea eugenioides] >XP_027159876.1 histone H3.2 [Coffea eugenioides] >XP_027160148.1 histone H3.2 [Coffea eugenioides] >XP_027349026.1 histone H3.2 [Abrus precatorius] >XP_028059636.1 histone H3.2 [Camellia sinensis] >XP_028062113.1 histone H3.2 [Camellia sinensis] >XP_028062657.1 histone H3.2 [Camellia sinensis] >XP_028091005.1 histone H3.2 [Camellia sinensis] >XP_028766104.1 histone H3.2 [Prosopis alba] >XP_028766551.1 histone H3.2 [Prosopis alba] >XP_028780018.1 histone H3.2 [Prosopis alba] >XP_028780300.1 histone H3.2 [Prosopis alba] >XP_028785404.1 histone H3.2 [Prosopis alba] >XP_028785405.1 histone H3.2 [Prosopis alba] >XP_028798076.1 histone H3.2 [Prosopis alba] >XP_028798794.1 histone H3.2 [Prosopis alba] >XP_030458509.1 histone H3.2 [Syzygium oleosum] >XP_030513195.1 histone H3.2 [Rhodamnia argentea] >XP_030514666.1 histone H3.2 [Rhodamnia argentea] >XP_030520599.1 histone H3.2 [Rhodamnia argentea] >XP_030524466.1 histone H3.2 [Rhodamnia argentea] >XP_030526735.1 histone H3.2 [Rhodamnia argentea] >XP_030528791.1 histone H3.2 [Rhodamnia argentea] >XP_030972002.1 histone H3.2 [Quercus lobata] >XP_031109229.1 histone H3.2 [Ipomoea triloba] >XP_031113703.1 histone H3.2 [Ipomoea triloba] >XP_031128373.1 histone H3.2 [Ipomoea triloba] >XP_031252073.1 histone H3.2 [Pistacia vera] >XP_031252107.1 histone H3.2 [Pistacia vera] >XP_031252108.1 histone H3.2 [Pistacia vera] >XP_031256219.1 histone H3.2 [Pistacia vera] >XP_031258004.1 histone H3.2 [Pistacia vera] >XP_031259289.1 histone H3.2 [Pistacia vera] >XP_031285062.1 histone H3.2 [Pistacia vera] >XP_031384573.1 histone H3.2 [Punica granatum] >XP_031388125.1 histone H3.2 [Punica granatum] >XP_031390487.1 histone H3.2 [Punica granatum] >XP_031401067.1 histone H3.2 [Punica granatum] >XP_031401282.1 histone H3.2 [Punica granatum] >XP_031401590.1 histone H3.2 [Punica granatum] >XP_031401592.1 histone H3.2 [Punica granatum] >XP_031496154.1 histone H3.2 [Nymphaea colorata] >XP_034218439.1 histone H3.2 [Prunus dulcis] >XP_034219485.1 histone H3.2 [Prunus dulcis] >XP_034219486.1 histone H3.2 [Prunus dulcis] >XP_034220463.1 histone H3.2 [Prunus dulcis] >XP_034587149.1 histone H3.2 [Setaria viridis] >XP_034590136.1 histone H3.2 [Setaria viridis] >XP_034591055.1 histone H3.2 [Setaria viridis] >XP_034597536.1 histone H3.2 [Setaria viridis] >XP_034601772.1 histone H3.2 [Setaria viridis] >XP_034603711.1 histone H3.2 [Setaria viridis] >XP_034676805.1 histone H3.2 [Vitis riparia] >XP_034677216.1 histone H3.2 [Vitis riparia] >XP_034683413.1 histone H3.2 [Vitis riparia] >XP_034687005.1 histone H3.2 [Vitis riparia] >XP_034687600.1 histone H3.2 [Vitis riparia] >XP_034705572.1 histone H3.2 [Vitis riparia] >XP_034888180.1 histone H3.2 [Populus alba] >XP_034888191.1 histone H3.2 [Populus alba] >XP_034888204.1 histone H3.2 [Populus alba] >XP_034904811.1 histone H3.2 [Populus alba] >XP_034919690.1 histone H3.2 [Populus alba] >XP_034930805.1 histone H3.2 [Populus alba] >XP_034930809.1 histone H3.2 [Populus alba] >XP_038690377.1 histone H3.2 [Tripterygium wilfordii] >XP_038698659.1 histone H3.2 [Tripterygium wilfordii] >XP_038701449.1 histone H3.2 [Tripterygium wilfordii] >XP_038712256.1 histone H3.2 [Tripterygium wilfordii] >XP_038719114.1 histone H3.2 [Tripterygium wilfordii] >XP_038878433.1 histone H3.2 [Benincasa hispida] >XP_038898051.1 histone H3.2 [Benincasa hispida] >XP_038898052.1 histone H3.2 [Benincasa hispida] >XP_038996577.1 histone H3.2 [Hibiscus syriacus] >XP_038996578.1 histone H3.2 [Hibiscus syriacus] >XP_038997697.1 histone H3.2 [Hibiscus syriacus] >XP_039009231.1 histone H3.2 [Hibiscus syriacus] >XP_039012578.1 histone H3.2 [Hibiscus syriacus] >XP_039014619.1 histone H3.2 [Hibiscus syriacus] >XP_039023798.1 histone H3.2 [Hibiscus syriacus] >XP_039024228.1 histone H3.2 [Hibiscus syriacus] >XP_039026180.1 histone H3.2 [Hibiscus syriacus] >XP_039033952.1 histone H3.2 [Hibiscus syriacus] >XP_039039047.1 histone H3.2 [Hibiscus syriacus] >XP_039059146.1 histone H3.2 [Hibiscus syriacus] >XP_039061604.1 histone H3.2 [Hibiscus syriacus] >XP_039061605.1 histone H3.2 [Hibiscus syriacus] >XP_039063236.1 histone H3.2 [Hibiscus syriacus] >XP_039066758.1 histone H3.2 [Hibiscus syriacus] >XP_039069795.1 histone H3.2 [Hibiscus syriacus] >XP_039116320.1 histone H3.2 [Dioscorea cayenensis subsp. rotundata] >XP_039117034.1 LOW QUALITY PROTEIN: histone H3.2-like [Dioscorea cayenensis subsp. rotundata] >XP_039126440.1 histone H3.2 [Dioscorea cayenensis subsp. rotundata] >XP_039772839.1 histone H3.2 [Panicum virgatum] >XP_039772840.1 histone H3.2 [Panicum virgatum] >XP_039789926.1 histone H3.2 [Panicum virgatum] >XP_039800830.1 histone H3.2 [Panicum virgatum] >XP_039806632.1 histone H3.2 [Panicum virgatum] >XP_039809829.1 histone H3.2 [Panicum virgatum] >XP_039812971.1 histone H3.2 [Panicum virgatum] >XP_039819500.1 histone H3.2 [Panicum virgatum] >XP_039819501.1 histone H3.2 [Panicum virgatum] >XP_039838176.1 histone H3.2 [Panicum virgatum] >XP_039844287.1 histone H3.2 [Panicum virgatum] >XP_039846434.1 histone H3.2 [Panicum virgatum] >XP_039850126.1 histone H3.2 [Panicum virgatum] >XP_040376401.1 histone H3.2 [Oryza brachyantha] >XP_040380773.1 histone H3.2 [Oryza brachyantha] >XP_040931201.1 histone H3.2 [Gossypium hirsutum] >XP_040931202.1 histone H3.2 [Gossypium hirsutum] >XP_040935603.1 histone H3.2 [Gossypium hirsutum] >XP_040941790.1 histone H3.2 [Gossypium hirsutum] >XP_040955497.1 histone H3.2 [Gossypium hirsutum] >A2Y533.1 RecName: Full=Histone H3.2 [Oryza sativa Indica Group] >P59226.2 RecName: Full=Histone H3.2; AltName: Full=Histone H3.1 [Arabidopsis thaliana] >P69246.2 RecName: Full=Histone H3.2 [Zea mays] >P69248.2 RecName: Full=Histone H3.2 [Petroselinum crispum] >Q2RAD9.1 RecName: Full=Histone H3.2 [Oryza sativa Japonica Group] >Q6LBE3.3 RecName: Full=Histone H3.2 [Asparagus officinalis] >Q6LCK1.3 RecName: Full=Histone H3.2 [Brassica napus] >Q71T45.3 RecName: Full=Histone H3.2 [Euphorbia esula] >Q76MV0.1 RecName: Full=Histone H3.2 [Nicotiana tabacum] >AAM95675.1 histone H3 [Orobanche cernua var. cumana] >ABK21761.1 unknown [Picea sitchensis] >ABS11143.1 histone H3 [Nicotiana benthamiana] >AIZ04726.1 histone 3 [Elettaria cardamomum] >EHA8591854.1 histone H3.2 [Cocos nucifera] >EPS69903.1 hypothetical protein M569_04854 [Genlisea aurea] >KAA0041388.1 histone H3.2 [Cucumis melo var. makuwa] >KAA3468344.1 histone H3.2 [Gossypium australe] >KAB1211931.1 histone H3.2 [Morella rubra] >KAB1671005.1 hypothetical protein [Gossypium barbadense] >KAB2601273.1 hypothetical protein D8674_002278 [Pyrus ussuriensis x Pyrus communis] >KAB8101321.1 hypothetical protein EE612_032078 [Oryza sativa] >KAB8703725.1 hypothetical protein FH972_026392 [Carpinus fangiana] >KAE9445672.1 hypothetical protein C3L33_22425, partial [Rhododendron williamsianum] >KAF0897254.1 hypothetical protein E2562_034723 [Oryza meyeriana var. granulata] >KAF2575008.1 hypothetical protein F2Q70_00000640 [Brassica cretica] >KAF3329922.1 histone H3.2 [Carex littledalei] >KAF3431842.1 hypothetical protein FNV43_RR26578 [Rhamnella rubrinervis] >KAF3942894.1 hypothetical protein CMV_030492 [Castanea mollissima] >KAF5185764.1 histone H3 [Thalictrum thalictroides] >KAF6158673.1 hypothetical protein GIB67_040187 [Kingdonia uniflora] >KAF7120819.1 hypothetical protein RHSIM_Rhsim13G0224800 [Rhododendron simsii] >KAF7803075.1 histone H3.2 [Senna tora] >KAF8009163.1 hypothetical protein BT93_J0218 [Corymbia citriodora subsp. variegata] >KAF8050225.1 hypothetical protein N665_2021s0002 [Sinapis alba] >KAF8377173.1 hypothetical protein HHK36_030546 [Tetracentron sinense] >KAF9587297.1 hypothetical protein IFM89_001021 [Coptis chinensis] >KAF9686452.1 hypothetical protein SADUNF_Sadunf03G0159900 [Salix dunnii] >KAF9825097.1 hypothetical protein H0E87_016722 [Populus deltoides] >KAG2256660.1 hypothetical protein Bca52824_075954 [Brassica carinata] >KAG2671258.1 hypothetical protein I3760_14G125200 [Carya illinoinensis] >KAG5227611.1 histone [Salix suchowensis] >KAG5516965.1 hypothetical protein RHGRI_037637 [Rhododendron griersonianum] >KAG5579274.1 hypothetical protein H5410_049901 [Solanum commersonii] >KAG6385319.1 hypothetical protein SASPL_154152 [Salvia splendens] >KAG6466975.1 hypothetical protein ZIOFF_075242 [Zingiber officinale] >KAG6570378.1 histone H3.2, partial [Cucurbita argyrosperma subsp. sororia] >KAG6748203.1 hypothetical protein POTOM_048112 [Populus tomentosa] >KFK25331.1 hypothetical protein AALP_AA8G099000 [Arabis alpina] >KZV18472.1 hypothetical protein F511_18040 [Dorcoceras hygrometricum] >MBA0555141.1 hypothetical protein [Gossypium lobatum] >MBA0610081.1 hypothetical protein [Gossypium davidsonii] >MBA0647191.1 hypothetical protein [Gossypium klotzschianum] >MBA0681114.1 hypothetical protein [Gossypium aridum] >MBA0708563.1 hypothetical protein [Gossypium laxum] >MBA0736209.1 hypothetical protein [Gossypium gossypioides] >MBA0762525.1 hypothetical protein [Gossypium trilobum] >MBA0797225.1 hypothetical protein [Gossypium harknessii] >MBA0827404.1 hypothetical protein [Gossypium armourianum] >MBA0852455.1 hypothetical protein [Gossypium schwendimanii] >MQL81797.1 hypothetical protein [Colocasia esculenta] >OEL28075.1 histone H3.2 [Dichanthelium oligosanthes] >OMO56171.1 histone H3 [Corchorus capsularis] >OMO73020.1 histone H3 [Corchorus olitorius] >OVA00004.1 histone H3 [Macleaya cordata] >PHT55884.1 histone H3.2 [Capsicum baccatum] >PHU26249.1 histone H3.2 [Capsicum chinense] >PIA35068.1 hypothetical protein AQUCO_03600018v1 [Aquilegia coerulea] >PIN00176.1 Histones H3 and H4 [Handroanthus impetiginosus] >PKA58246.1 Histone H3.2 [Apostasia shenzhenica] >PON52626.1 histone H3/CENP-A [Parasponia andersonii] >PON57118.1 histone H3/CENP-A [Trema orientale] >PQM33280.1 hypothetical protein Pyn_34678 [Prunus yedoensis var. nudiflora] >PSR95393.1 histone H3.2 like [Actinidia chinensis var. chinensis] >PUZ47123.1 hypothetical protein GQ55_7G138000 [Panicum hallii var. hallii] >QIH54373.1 histone [Brassica juncea] >RLM54700.1 hypothetical protein C2845_PM10G03330 [Panicum miliaceum] >RRT51158.1 hypothetical protein B296_00016109 [Ensete ventricosum] >RWR96397.1 histone H3.2 [Cinnamomum micranthum f. kanehirae] >THG17424.1 hypothetical protein TEA_027700 [Camellia sinensis var. sinensis] >THU50268.1 hypothetical protein C4D60_Mb06t18400 [Musa balbisiana] >TMW81332.1 hypothetical protein EJD97_010277 [Solanum chilense] >TQD88194.1 hypothetical protein C1H46_026255 [Malus baccata] >TVU01787.1 hypothetical protein EJB05_52783, partial [Eragrostis curvula] >TXG60132.1 hypothetical protein EZV62_014705 [Acer yangbiense] >TYG38946.1 hypothetical protein ES288_D13G264800v1 [Gossypium darwinii] >TYH35053.1 hypothetical protein ES332_D13G167200v1 [Gossypium tomentosum] >TYI47261.1 hypothetical protein E1A91_D13G160600v1 [Gossypium mustelinum] >CAA2954328.1 histone [Olea europaea subsp. europaea] >CAA7027184.1 unnamed protein product [Microthlaspi erraticum] >CAA7405228.1 unnamed protein product [Spirodela intermedia] >CAB3446829.1 unnamed protein product [Digitaria exilis] >CAB4276163.1 unnamed protein product [Prunus armeniaca] >CAD1836808.1 unnamed protein product [Ananas comosus var. bracteatus] >CAD6235764.1 unnamed protein product [Miscanthus lutarioriparius] >CAE5956951.1 unnamed protein product [Arabidopsis arenosa] >CCD74495.1 histone H3 [Arabidopsis halleri subsp. halleri] >CDP07721.1 unnamed protein product [Coffea canephora] >VDC85801.1 unnamed protein product [Brassica oleracea] >VVA90586.1 unnamed protein product [Arabis nemorensis] >BAX24935.1 histone H3 [Oryza punctata] >GAY41411.1 hypothetical protein CUMW_059240 [Citrus unshiu] >GER25072.1 histone H3 [Striga asiatica] >GFP79747.1 histone h3.2 [Phtheirospermum japonicum] >GFS30272.1 histone superfamily protein [Actinidia rufa] >prf||1303352A histone H3 [Helicoverpa zea])

HSP 1 Score: 249 bits (636), Expect = 5.810e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: PIA53463.1 (hypothetical protein AQUCO_00900211v1, partial [Aquilegia coerulea])

HSP 1 Score: 249 bits (636), Expect = 6.880e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    6 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 141
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: CDP18134.1 (unnamed protein product [Coffea canephora])

HSP 1 Score: 249 bits (635), Expect = 8.260e-83
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVT+MPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTVMPKDIQLARRIRGERA 136
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: XP_017621393.1 (PREDICTED: histone H3.2-like [Gossypium arboreum] >EHA8591633.1 histone H3.2 [Cocos nucifera])

HSP 1 Score: 249 bits (635), Expect = 8.260e-83
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 136
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: KAB1768587.1 (histone H3, partial [Klebsiella pneumoniae])

HSP 1 Score: 249 bits (636), Expect = 8.410e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   12 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 147
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: KAB1717009.1 (histone H3, partial [Klebsiella pneumoniae])

HSP 1 Score: 249 bits (636), Expect = 9.310e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   15 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 150
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: KAG5627405.1 (hypothetical protein H5410_012623 [Solanum commersonii])

HSP 1 Score: 249 bits (636), Expect = 9.950e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   17 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 152
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: VDD10577.1 (unnamed protein product, partial [Brassica oleracea])

HSP 1 Score: 249 bits (636), Expect = 9.950e-83
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   17 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 152
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: VDD30093.1 (unnamed protein product, partial [Brassica oleracea])

HSP 1 Score: 249 bits (636), Expect = 1.100e-82
Identity = 136/136 (100.00%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:   20 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 155
[Close]
BLAST of BolC9t59475H-R vs. GenBank_protein
Match: MBA0812168.1 (hypothetical protein [Gossypium harknessii])

HSP 1 Score: 248 bits (634), Expect = 1.170e-82
Identity = 135/136 (99.26%), Postives = 136/136 (100.00%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVG+FEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAYLVGMFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
The following BLAST results are available for this feature:
BLAST of BolC9t59475H-R vs. GenBank_protein
Analysis Date: 2022-03-19 (Diamond on OGS1.0 vs NR)
Total hits: 20
Match NameE-valueIdentityDescription
NP_001131276.15.810e-83100.00histone H3.2 [Zea mays] >NP_189372.1 Histone super... [more]
PIA53463.16.880e-83100.00hypothetical protein AQUCO_00900211v1, partial [Aq... [more]
CDP18134.18.260e-8399.26unnamed protein product [Coffea canephora][more]
XP_017621393.18.260e-8399.26PREDICTED: histone H3.2-like [Gossypium arboreum] ... [more]
KAB1768587.18.410e-83100.00histone H3, partial [Klebsiella pneumoniae][more]
KAB1717009.19.310e-83100.00histone H3, partial [Klebsiella pneumoniae][more]
KAG5627405.19.950e-83100.00hypothetical protein H5410_012623 [Solanum commers... [more]
VDD10577.19.950e-83100.00unnamed protein product, partial [Brassica olerace... [more]
VDD30093.11.100e-82100.00unnamed protein product, partial [Brassica olerace... [more]
MBA0812168.11.170e-8299.26hypothetical protein [Gossypium harknessii][more]

Pages

back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category Term Accession Term Name
cellular_component GO:0010369 chromocenter
cellular_component GO:0000786 nucleosome
cellular_component GO:0005634 nucleus
molecular_function GO:0003677 DNA binding
molecular_function GO:0046982 protein heterodimerization activity
InterPro
Analysis Name: Interproscan on OGS1.0
Date Performed: 2022-03-19
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000164Histone H3/CENP-APRINTSPR00622HISTONEH3coord: 114..135
score: 94.86
coord: 98..114
score: 96.93
coord: 34..55
score: 89.33
coord: 80..98
score: 85.01
coord: 3..17
score: 97.1
coord: 17..31
score: 92.32
coord: 58..75
score: 97.46
IPR000164Histone H3/CENP-ASMARTSM00428h35coord: 34..136
e-value: 8.4E-74
score: 261.2
IPR000164Histone H3/CENP-APANTHERPTHR11426HISTONE H3coord: 1..136
IPR000164Histone H3/CENP-APROSITEPS00959HISTONE_H3_2coord: 67..75
IPR000164Histone H3/CENP-APROSITEPS00322HISTONE_H3_1coord: 15..21
IPR007125Histone H2A/H2B/H3PFAMPF00125Histonecoord: 1..132
e-value: 1.0E-53
score: 181.2
IPR009072Histone-foldGENE3D1.10.20.10Histone, subunit Acoord: 2..136
e-value: 1.4E-75
score: 253.6
IPR009072Histone-foldSUPERFAMILY47113Histone-foldcoord: 2..133
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..43
NoneNo IPR availablePANTHERPTHR11426:SF198SUBFAMILY NOT NAMEDcoord: 1..136

Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
C9contigC9:59312343..59312753 +
Analyses
This polypeptide is derived from or has results from the following analyses
Analysis NameDate Performed
Interproscan on OGS1.02022-03-19
Blast2go on OGS1.02022-03-19
Diamond on OGS1.0 vs NR2022-03-19
Brassica oleracea HDEM OGS1.02018-11-02
Relationships

This polypeptide derives from the following mRNA feature(s):

Feature NameUnique NameSpeciesTypePosition
BolC9t59475H-RBolC9t59475H-RBrassica oleracea HDEMmRNAC9 59312343..59312753 +


Sequences
The following sequences are available for this feature:

polypeptide sequence

>BolC9t59475H-R-P ID=BolC9t59475H-R-P|Name=BolC9t59475H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=137bp
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRFRPGTVALR
EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVAALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA.
back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
TermDefinition
IPR009072Histone-fold
IPR007125Histone_H2A/H2B/H3
IPR000164Histone_H3/CENP-A
Vocabulary: Molecular Function
TermDefinition
GO:0046982protein heterodimerization activity
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0010369chromocenter
GO:0005634nucleus
GO:0000786nucleosome