Homology
BLAST of BolSC49t61187H-R vs. GenBank_protein
Match: VDD65959.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 78.2 bits (191), Expect = 5.880e-18 Identity = 42/42 (100.00%), Postives = 42/42 (100.00%), Query Frame = 0 Query: 1 MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV 42
MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV
Sbjct: 1 MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV 42
The following BLAST results are available for this feature:
BLAST of BolSC49t61187H-R vs. GenBank_protein
Analysis Date: 2022-03-19 ( Diamond on OGS1.0 vs NR)
Total hits: 1
Match Name | E-value | Identity | Description | |
VDD65959.1 | 5.880e-18 | 100.00 | unnamed protein product [Brassica oleracea] | [more] |
back to top
GO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Category |
Term Accession |
Term Name |
cellular_component |
GO:0016021 |
integral component of membrane |
InterPro
Analysis Name: Interproscan on OGS1.0
Date Performed: 2022-03-19
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..5 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 6..25 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 26..42 |
None | No IPR available | TMHMM | TMhelix | | coord: 7..29 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >BolSC49t61187H-R-P ID=BolSC49t61187H-R-P|Name=BolSC49t61187H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=43bp MIFSGHFLIISSAIPVLAFLISGVLSPITKGPEKLFLVMNQV. back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: Cellular Component
Term | Definition |
GO:0016021 | integral component of membrane |
|