BolSC47t61120H-R-P (polypeptide) Brassica oleracea HDEM
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: VDD65892.1 (unnamed protein product [Brassica oleracea]) HSP 1 Score: 85.1 bits (209), Expect = 8.130e-21 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0 Query: 1 MIAIRGLKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 MIAIRGLKRILMPESWIGWPLRKDYIAPIFMKYKMLIE Sbjct: 1 MIAIRGLKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: KAG0538069.1 (hypothetical protein BDA96_03G203500 [Sorghum bicolor]) HSP 1 Score: 69.3 bits (168), Expect = 1.580e-13 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 LKRILMPESWIGWPLRKDYI PI MKYKMLIE Sbjct: 105 LKRILMPESWIGWPLRKDYITPISMKYKMLIE 136
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: CAA9893341.1 (unnamed protein product [Spirodela intermedia]) HSP 1 Score: 69.3 bits (168), Expect = 2.610e-13 Identity = 30/32 (93.75%), Postives = 30/32 (93.75%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 LKRILMPESWIGWPLRKDYI PI MKYKMLIE Sbjct: 128 LKRILMPESWIGWPLRKDYITPISMKYKMLIE 159
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: QHN86084.1 (NAD(P)H-quinone oxidoreductase subunit J [Arachis hypogaea]) HSP 1 Score: 69.3 bits (168), Expect = 2.610e-13 Identity = 29/32 (90.62%), Postives = 31/32 (96.88%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 LKRILMPE+WIGWPLRKDYIAPIFMKYKML + Sbjct: 128 LKRILMPENWIGWPLRKDYIAPIFMKYKMLTK 159
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: PVH34240.1 (hypothetical protein PAHAL_8G179000 [Panicum hallii]) HSP 1 Score: 66.6 bits (161), Expect = 1.880e-12 Identity = 29/32 (90.62%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 LKRILMPESWIGWPLRKDYI P MKYKMLIE Sbjct: 107 LKRILMPESWIGWPLRKDYITPNSMKYKMLIE 138
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: AFK48896.1 (unknown [Lotus japonicus]) HSP 1 Score: 63.9 bits (154), Expect = 5.060e-11 Identity = 27/32 (84.38%), Postives = 29/32 (90.62%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLIE 38 LKRILMPESWIGWPLRKDYIAP F +YKML + Sbjct: 150 LKRILMPESWIGWPLRKDYIAPNFYEYKMLTK 181
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: YP_009936598.1 (NADH-plastoquinone oxidoreductase subunit J [Paphiopedilum barbigerum] >QNT11225.1 NADH-plastoquinone oxidoreductase subunit J [Paphiopedilum barbigerum] >QUV74528.1 NADH-plastoquinone oxidoreductase subunit J [Paphiopedilum tranlienianum]) HSP 1 Score: 60.1 bits (144), Expect = 2.650e-10 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAP--IFMKYKMLIE 38 LKRILMPE+WIGW LRKDYIAP I MKYKML E Sbjct: 63 LKRILMPENWIGWSLRKDYIAPLPISMKYKMLFE 96
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: QUV74946.1 (NADH-plastoquinone oxidoreductase subunit J [Paphiopedilum violascens]) HSP 1 Score: 60.1 bits (144), Expect = 4.510e-10 Identity = 28/34 (82.35%), Postives = 29/34 (85.29%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAP--IFMKYKMLIE 38 LKRILMPE+WIGW LRKDYIAP I MKYKML E Sbjct: 86 LKRILMPENWIGWSLRKDYIAPLPISMKYKMLFE 119
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: ABY57492.1 (NADH dehydrogenase subunit J, partial [Solanum tuberosum]) HSP 1 Score: 58.9 bits (141), Expect = 1.480e-9 Identity = 25/31 (80.65%), Postives = 28/31 (90.32%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAPIFMKYKMLI 37 LKRILMPESWIGWPLRKDYIAP F + ++LI Sbjct: 96 LKRILMPESWIGWPLRKDYIAPNFYEIQVLI 126
BLAST of BolSC47t61120H-R vs. GenBank_protein
Match: QUV74779.1 (NADH-plastoquinone oxidoreductase subunit J [Paphiopedilum kolopakingii]) HSP 1 Score: 58.5 bits (140), Expect = 1.770e-9 Identity = 27/34 (79.41%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 7 LKRILMPESWIGWPLRKDYIAP--IFMKYKMLIE 38 LKRILMPE+WIGW LRKDYI P I MKYKML E Sbjct: 85 LKRILMPENWIGWSLRKDYITPLPISMKYKMLFE 118 The following BLAST results are available for this feature:
BLAST of BolSC47t61120H-R vs. GenBank_protein
Analysis Date: 2022-03-19 (Diamond on OGS1.0 vs NR) Total hits: 20 ZOOMx 1POSITION0
Pagesback to topGO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
InterPro
Analysis Name: Interproscan on OGS1.0
Date Performed: 2022-03-19 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >BolSC47t61120H-R-P ID=BolSC47t61120H-R-P|Name=BolSC47t61120H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=39bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|