BolC1t00275H-R (mRNA) Brassica oleracea HDEM
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >BolC1t00275H-R ID=BolC1t00275H-R|Name=BolC1t00275H-R|organism=Brassica oleracea HDEM|type=mRNA|length=465bp|location=Sequence derived from alignment at C1:1524565..1525545+ (Brassica oleracea HDEM)|Notes=Excludes all bases but those of type(s): exon. ATGCATCTTCCACATGTACAAACTAACAGGGCCTATCCTTTGGATTCTTTback to top protein sequence of BolC1t00275H-R >BolC1t00275H-R-P ID=BolC1t00275H-R-P|Name=BolC1t00275H-R|organism=Brassica oleracea HDEM|type=polypeptide|length=155bp MHLPHVQTNRAYPLDSLPQEFDPCHLVELNLSYSHLQKLWGGTKNLDMLKback to top mRNA from alignment at C1:1524565..1525545+ Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>BolC1t00275H-R ID=BolC1t00275H-R|Name=BolC1t00275H-R|organism=Brassica oleracea HDEM|type=mRNA|length=981bp|location=Sequence derived from alignment at C1:1524565..1525545+ (Brassica oleracea HDEM)back to top Coding sequence (CDS) from alignment at C1:1524565..1525545+ >BolC1t00275H-R ID=BolC1t00275H-R|Name=BolC1t00275H-R|organism=Brassica oleracea HDEM|type=CDS|length=465bp|location=Sequence derived from alignment at C1:1524565..1525545+ (Brassica oleracea HDEM)back to top Orthology
View orthology data for BolC1t00275H-R
|