BnaA01T0065900WE (mRNA) Brassica napus Westar
|
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >BnaA01T0065900WE ID=BnaA01T0065900WE|Name=BnaA01T0065900WE|organism=Brassica napus Westar|type=mRNA|length=210bp|location=Sequence derived from alignment at westarv0_A01:4524363..4524789- (Brassica napus Westar)|Notes=Excludes all bases but those of type(s): exon. ATGGATGCCATCGATTCAGTCGTCGATCCTCTAAGAGACTTTGCGAAGGAback to top protein sequence of BnaA01T0065900WE >BnaA01T0065900WE-P ID=BnaA01T0065900WE-P|Name=BnaA01T0065900WE|organism=Brassica napus Westar|type=polypeptide|length=70bp MDAIDSVVDPLRDFAKDSIRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVback to top mRNA from alignment at westarv0_A01:4524363..4524789- Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.>BnaA01T0065900WE ID=BnaA01T0065900WE|Name=BnaA01T0065900WE|organism=Brassica napus Westar|type=mRNA|length=427bp|location=Sequence derived from alignment at westarv0_A01:4524363..4524789- (Brassica napus Westar)back to top Coding sequence (CDS) from alignment at westarv0_A01:4524363..4524789- >BnaA01T0065900WE ID=BnaA01T0065900WE|Name=BnaA01T0065900WE|organism=Brassica napus Westar|type=CDS|length=210bp|location=Sequence derived from alignment at westarv0_A01:4524363..4524789- (Brassica napus Westar)back to top Orthology
View orthology data for BnaA01T0065900WE
|