Bnascaffold610T0000400WE-P (polypeptide) Brassica napus Westar
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: KAF8053482.1 (hypothetical protein N665_1411s0013 [Sinapis alba]) HSP 1 Score: 78.2 bits (191), Expect = 1.490e-15 Identity = 39/74 (52.70%), Postives = 42/74 (56.76%), Query Frame = 0 Query: 7 TLGWVARSAFGEHRSACLFCRRYAPGLNWPG------------------------------FRSYCVGLRDRSN 50 TLGWVARSAFGEHR AC FCRRYAPGLNWPG FRSYCVGLRD+++ Sbjct: 13 TLGWVARSAFGEHRLACPFCRRYAPGLNWPGRASGAVTLKKLECSKQAYALYTLAWDNIIGFRSYCVGLRDQTS 86
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: KAF2123271.1 (hypothetical protein P153DRAFT_179268 [Dothidotthia symphoricarpi CBS 119687]) HSP 1 Score: 75.5 bits (184), Expect = 5.830e-15 Identity = 37/48 (77.08%), Postives = 37/48 (77.08%), Query Frame = 0 Query: 96 KTIRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRGEYGRKAET 143 KTIRYR SLN K CR GI C F DS GTL EIKVFGF GEYGRKAET Sbjct: 5 KTIRYRRSLNRKLCRLGIGRCSFSDSLGTLREIKVFGFWGEYGRKAET 52
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: PWY62173.1 (hypothetical protein BO70DRAFT_406767, partial [Aspergillus heteromorphus CBS 117.55]) HSP 1 Score: 75.1 bits (183), Expect = 8.630e-15 Identity = 38/54 (70.37%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 90 TKVGGSKTIRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRGEYGRKAET 143 TKV GSKTIRYR SLNHK CR GI C + D GTL EIKVFGF G RKAET Sbjct: 1 TKVRGSKTIRYRRSLNHKLCRLGIGRCFYYDPFGTLREIKVFGFWGSMVRKAET 54
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: CQB88529.1 (Uncharacterised protein [Chlamydia trachomatis]) HSP 1 Score: 73.2 bits (178), Expect = 4.150e-14 Identity = 35/46 (76.09%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 98 IRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRGEYGRKAET 143 IRYR SLNHK CR GI C F D+ GTL EIKVFGF GEYGRKAET Sbjct: 2 IRYRRSLNHKLCRLGIGCCSFIDAIGTLREIKVFGFWGEYGRKAET 47
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: MZZ63249.1 (hypothetical protein [Enterococcus mundtii]) HSP 1 Score: 72.4 bits (176), Expect = 8.270e-14 Identity = 35/46 (76.09%), Postives = 35/46 (76.09%), Query Frame = 0 Query: 98 IRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRGEYGRKAET 143 IRYR SLNHK CR GI C F D GTL EIKVFGF GEYGRKAET Sbjct: 2 IRYRRSLNHKLCRLGIGWCFFNDPLGTLREIKVFGFWGEYGRKAET 47
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: RXI09690.1 (hypothetical protein DVH24_014697 [Malus domestica]) HSP 1 Score: 75.1 bits (183), Expect = 1.120e-13 Identity = 42/79 (53.16%), Postives = 42/79 (53.16%), Query Frame = 0 Query: 3 ARSXTLGWVARSAFGEHRSACLFCRRYAPGLNWPG------------------------------FRSYCVGLRDRSND 51 ARS TLGWV RSA G HRSA FCRRYAPGLNWPG FRSY VGLRDRSND Sbjct: 78 ARSWTLGWVDRSASGVHRSARPFCRRYAPGLNWPGRASGAVTLKKLECSKQAYALNTLAWDNIIGFRSYSVGLRDRSND 156
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: RAN66223.1 (hypothetical protein B5P40_32165, partial [Bacillus sp. SRB_8]) HSP 1 Score: 70.1 bits (170), Expect = 1.440e-12 Identity = 39/79 (49.37%), Postives = 40/79 (50.63%), Query Frame = 0 Query: 3 ARSXTLGWVARSAFGEHRSACLFCRRYAPGLNWPG------------------------------FRSYCVGLRDRSND 51 ARS TLGW RSA G HRS+ FCRR APGLNWPG FRSY VGLRDRSND Sbjct: 1 ARSWTLGWAGRSALGVHRSSRPFCRRCAPGLNWPGRASGAVTLKKLECSKQAYALYTLAWDNIIGFRSYYVGLRDRSND 79
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: RXI09570.1 (hypothetical protein DVH24_033638 [Malus domestica]) HSP 1 Score: 68.9 bits (167), Expect = 4.050e-12 Identity = 38/74 (51.35%), Postives = 38/74 (51.35%), Query Frame = 0 Query: 8 LGWVARSAFGEHRSACLFCRRYAPGLNWPG------------------------------FRSYCVGLRDRSND 51 LGWV RSA G HRSA FCRRYAPGLNWPG FRSY VGLRDRSND Sbjct: 6 LGWVDRSASGVHRSARPFCRRYAPGLNWPGRASGAVTLKKLECSKQAYALNTLAWDNIIGFRSYSVGLRDRSND 79
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: PKX88299.1 (hypothetical protein P174DRAFT_380670, partial [Aspergillus novofumigatus IBT 16806]) HSP 1 Score: 68.2 bits (165), Expect = 6.240e-12 Identity = 33/46 (71.74%), Postives = 34/46 (73.91%), Query Frame = 0 Query: 90 TKVGGSKTIRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRG 135 TKV GSKTIRYR SLNHK CR GI C + D GTL EIKVFGF G Sbjct: 1 TKVRGSKTIRYRRSLNHKLCRLGIGRCFYDDPLGTLREIKVFGFWG 46
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Match: KYB24678.1 (hypothetical protein TcasGA2_TC031862 [Tribolium castaneum]) HSP 1 Score: 68.2 bits (165), Expect = 6.910e-12 Identity = 33/54 (61.11%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 90 TKVGGSKTIRYRPSLNHKRCRPGISGCCFXDSAGTLXEIKVFGFRGEYGRKAET 143 TKV GSK I YRPS N KRC+ I C DSAG+ E + FGFRG+YG KAET Sbjct: 20 TKVRGSKAIGYRPSSNDKRCQLAIRRCSSDDSAGSFRETQAFGFRGKYGCKAET 73 The following BLAST results are available for this feature:
BLAST of Bnascaffold610T0000400WE vs. GenBank_protein
Analysis Date: 2022-04-13 (Diamond on OGS1.0 vs NR) Total hits: 20 ZOOMx 1POSITION0
Pagesback to topGO Annotation
GO Assignments
This polypeptide is annotated with the following GO terms.
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Bnascaffold610T0000400WE-P ID=Bnascaffold610T0000400WE-P|Name=Bnascaffold610T0000400WE|organism=Brassica napus Westar|type=polypeptide|length=159bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|