A01p06270.1_BnaDARv10-RA (mRNA) Brassica napus
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=mRNA|length=373bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)|Notes=Excludes all bases but those of type(s): exon. GTCGAATGATGTAAAAAGAAATCGGAGATTGTTGAATTTTCTTTCCAAAGback to top protein sequence of A01p06270.1_BnaDARv10-RA >A01p06270.1_BnaDARv10-PA ID=A01p06270.1_BnaDARv10-PA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=polypeptide|length=63bp MQGGDHLSACKVSYQSSVISFLLKLSFVIIMISTYSQTVNNQLTHKPFEYback to top mRNA from alignment at A01_BnaDARv10:2831280..2831652+ Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=mRNA|length=373bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)back to top Coding sequence (CDS) from alignment at A01_BnaDARv10:2831280..2831652+ >A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=CDS|length=189bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)back to top Metabolic Model
View data from metabolic model for A01p06270.1_BnaDARv10-RA
|