A01p06270.1_BnaDARv10-RA (mRNA) Brassica napus
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
This mRNA is a part of the following gene feature(s):
The following five_prime_UTR feature(s) are a part of this mRNA:
The following exon feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following three_prime_UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
spliced messenger RNA >A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=mRNA|length=373bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)|Notes=Excludes all bases but those of type(s): exon. GTCGAATGATGTAAAAAGAAATCGGAGATTGTTGAATTTTCTTTCCAAAGback to top protein sequence of A01p06270.1_BnaDARv10-RA >A01p06270.1_BnaDARv10-PA ID=A01p06270.1_BnaDARv10-PA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=polypeptide|length=63bp MQGGDHLSACKVSYQSSVISFLLKLSFVIIMISTYSQTVNNQLTHKPFEYback to top mRNA from alignment at A01_BnaDARv10:2831280..2831652+ Legend: five_prime_UTRexonpolypeptideCDSthree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.>A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=mRNA|length=373bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)back to top Coding sequence (CDS) from alignment at A01_BnaDARv10:2831280..2831652+ >A01p06270.1_BnaDARv10-RA ID=A01p06270.1_BnaDARv10-RA|Name=A01p06270.1_BnaDARv10-RA|organism=Brassica napus|type=CDS|length=189bp|location=Sequence derived from alignment at A01_BnaDARv10:2831280..2831652+ (Brassica napus)back to top Metabolic Model
View data from metabolic model for A01p06270.1_BnaDARv10-RA
|